.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l0q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of xylulose kinase from Yersinia pseudotuberculosis. To be Published
    Site NYSGXRC
    PDB Id 3l0q Target Id NYSGXRC-11200d
    Related PDB Ids 3gg4 
    Molecular Characteristics
    Source Yersinia pseudotuberculosis
    Alias Ids TPS27122,PF00370, 3.30.420.40, YP_072074.1 Molecular Weight 59457.75 Da.
    Residues 545 Isoelectric Point 6.14
    Sequence masyfigvdvgtgsaragvfdlqgrmvgqasreitmfkpkadfveqsseniwqavcnavrdavnqadin piqvkglgfdatcslvvldkegnpltvspsgrneqnvivwmdhraitqaerinatkhpvlefvggvisp emqtpkllwlkqhmpntwsnvghlfdlpdfltwratkdetrslcstvckwtylghedrwdpsyfklvgl adlldnnaakigatvkpmgaplghglsqraasemglipgtavsvsiidahagtigilgasgvtgenanf drrialiggtstahmamsrsahfisgiwgpyysailpeywlneggqsatgalidhiiqshpcypalleq aknkgetiyealnyilrqmagepeniafltndihmlpyfhgnrspranpnltgiitglklsttpedmal rylatiqalalgtrhiietmnqngynidtmmasgggtknpifvqehanatgcamllpeeseamllgsam mgtvaagvfeslpeamaamsrigktvtpqtnkikayydrkyrvfhqmyhdhmryqalmqega
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.61 Rfree 0.2222
    Matthews' coefficent 2.18 Rfactor 0.1915
    Waters 900 Solvent Content 43.69

    Ligand Information
    Ligands XUL (D-XYLULOSE) x 1;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch