.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l60

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Branched-Chain Alpha-Keto Acid Dehydrogenase Subunit E2 from Mycobacterium Tuberculosis. To be Published
    Site NYSGXRC
    PDB Id 3l60 Target Id NYSGXRC-13665a
    Molecular Characteristics
    Source Mycobacterium tuberculosis
    Alias Ids TPS31556,PF00364, CAB08928.1 Molecular Weight 41058.69 Da.
    Residues 393 Isoelectric Point 5.23
    Sequence msgedsirsfpvpdlgeglqevtvtcwsvavgddveinqtlcsvetakaeveipspyagrivelggaeg dvlkvgaelvridtgptavaqpngegavptlvgygadtaietsrrtsrplaapvvrklakelavdlaal qrgsgaggvitradvlaaarggvgagpdvrpvhgvharmaekmtlshkeiptakasvevicaellrlrd rfvsaapeitpfaltlrllvialkhnvilnstwvdsgegpqvhvhrgvhlgfgaatergllvpvvtdaq dkntrelasrvaelitgaregtltpaelrgstftvsnfgalgvddgvpvinhpeaailglgaikprpvv vggevvarptmtltcvfdhrvvdgaqvaqfmcelrdliespetalldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.22217
    Matthews' coefficent 2.62 Rfactor 0.18185
    Waters 140 Solvent Content 53.09

    Ligand Information
    Ligands UNL (UNKNOWN) x 1
    Metals

    Jmol

     
    Google Scholar output for 3l60
    1. The progress made in determining the Mycobacterium tuberculosis structural proteome
    MT Ehebauer, M Wilmanns - Proteomics, 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch