.
The Open Protein Structure Annotation Network
PDB Keyword
.

3l6d

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative oxidoreductase from Pseudomonas putida KT2440. To be Published
    Site NYSGXRC
    PDB Id 3l6d Target Id NYSGXRC-11130d
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS31627,AAN68406.1, 3.40.50.720 Molecular Weight 32474.01 Da.
    Residues 302 Isoelectric Point 5.99
    Sequence vrehsdesfefdvsviglgamgtimaqvllkqgkrvaiwnrspgkaaalvaagahlcesvkaalsaspa tifvlldnhathevlgmpgvaralahrtivdyttnaqdeglalqglvnqagghyvkgmivayprnvghr eshsihtgdreafeqhralleglaghtvflpwdealafatvlhahafaamvtffeavgagdrfglpvsk tarllletsrffvadaleeavrrletqdfkgdqarldvhadafahiaqslhaqgvwtpvfdavcqvvqr aaamgygdqdiaattksfareqepgh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.260
    Matthews' coefficent 2.48 Rfactor 0.208
    Waters 314 Solvent Content 50.31

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch