The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of methyltransferase from Bacillus Thuringiensis. To be Published
    Site NYSGXRC
    PDB Id 3l8d Target Id NYSGXRC-11125h
    Molecular Characteristics
    Source Bacillus thuringiensis
    Alias Ids TPS31624,YP_894696.1, Molecular Weight 27628.24 Da.
    Residues 242 Isoelectric Point 5.49
    Sequence vkvgecmtkfnwhesaekkwdssaefwnqnsqemwdsgsrstiipffeqyvkkeaevldvgcgdgygty klsrtgykavgvdisevmiqkgkergegpdlsfikgdlsslpfeneqfeaimainslewteeplralne ikrvlksdgyaciailgptakprensyprlygkdvvcntmmpwefeqlvkeqgfkvvdgigvykrgvne kmlgqlstdlqqsltflwvfmlkrhkemkeflggk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.225
    Matthews' coefficent 2.48 Rfactor 0.211
    Waters 136 Solvent Content 50.38

    Ligand Information
    Metals K (POTASSIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch