.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lhx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a Ketodeoxygluconokinase (kdgk) from Shigella flexneri. To be Published
    Site NYSGXRC
    PDB Id 3lhx Target Id NYSGXRC-13638c
    Molecular Characteristics
    Source Shigella flexneri
    Alias Ids TPS31554,PF00294, AAP19174.1 Molecular Weight 42416.83 Da.
    Residues 382 Isoelectric Point 7.14
    Sequence vfksdaartrqrlsarkgrtlppgrgkfphsttesfrntfwlkkimehcfnmvdqqtttaqtnanflqi rfttmskkiavigecmielsekgadvkrgfggdtlntsvyiarqvdpaaltvhyvtalgtdsfsqqmld awhgenvdtsltqrmenrlpglyyietdstgertfyywrneaaakfwlaseqsaaiceelanfdylyls gislailsptsrekllsllrecrakggkvifdnnyrprlwaskeetqqvyqqmlectdiafltlddeda lwgqqpvedviarthnagvkevvvkrgadsclvsiagealvdvpavklpkekvidttaagdsfsagyla vrltggsaenaakrghltastviqyrgaiipreampa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.259
    Matthews' coefficent 2.31 Rfactor 0.215
    Waters 182 Solvent Content 46.74

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch