.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lkb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a branched chain amino acid ABC transporter from Thermus thermophilus with bound valine. To be Published
    Site NYSGXRC
    PDB Id 3lkb Target Id NYSGXRC-11235g
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS31678,3.40.50.2300, YP_143717.1, PF01094 Molecular Weight 44572.76 Da.
    Residues 407 Isoelectric Point 9.07
    Sequence mglakggkrmrrtlagiaavlglalgqqqvtlfwsgaitgptsdagapygaavedyckwanerklvpgv vfncvvrddqynnantqrffeeavdrfkipvflsyatganlqlkpliqelriptipasmhielidppnn dyiflpttsyseqvvalleyiarekkgakvalvvhpspfgrapvedarkaarelglqivdvqevgsgnl dntallkrfeqagveyvvhqnvagpvanilkdakrlglkmrhlgahytggpdlialagdaaegflwats fymahedtpgirlqkeigrkygrpenfiesvnytngmlvasiaveairraqerfkritnetvyqaivgm ngpnafkpgfavstkqgveidftksehtgaeglrileakggrfvpvtepftsalfrkvhygk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.23611
    Matthews' coefficent 2.25 Rfactor 0.17402
    Waters 129 Solvent Content 45.27

    Ligand Information
    Ligands VAL (ISOPROPYL) x 2;IPA x 2
    Metals NA (SODIUM) x 2

    Jmol

     
    Google Scholar output for 3lkb
    1. Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins
    K Michalska, C Chang, JC Mack, S Zerbs - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch