The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of enoyl-CoA hydratase from Bacillus halodurans. To be Published
    Site NYSGXRC
    PDB Id 3lke Target Id NYSGXRC-11251j
    Molecular Characteristics
    Source Bacillus halodurans
    Alias Ids TPS31689,, PF00378, NP_242715.1 Molecular Weight 28559.44 Da.
    Residues 253 Isoelectric Point 6.12
    Sequence msyvhteiqndalyitldypekkngldaelgtslleairagnnetsihsiilqskhrayfssgprledl licasdqsdvrlrevlhvlnhcvleiftspkvtvalingyaygggfnmmlacdrrialrrakflenfhk mgispdlgasyflpriigyeqtmnlllegklftseealrlgliqeicenkqelqervknylkavsegyv paiaatkkllkgkaaeelkqqleqeteelvalfkqteikkrlealv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.70 Rfree 0.240
    Matthews' coefficent 2.27 Rfactor 0.216
    Waters 218 Solvent Content 45.84

    Ligand Information
    Ligands GOL (GLYCEROL) x 3



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch