.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lki

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Fructokinase with bound ATP from Xylella fastidiosa. To be Published
    Site NYSGXRC
    PDB Id 3lki Target Id NYSGXRC-11206h
    Related PDB Ids 3ljs 
    Molecular Characteristics
    Source Xylella fastidiosa
    Alias Ids TPS31659,PF00294, AAO29016.1, 3.40.1190.20 Molecular Weight 36044.05 Da.
    Residues 338 Isoelectric Point 4.75
    Sequence vsvalsidlskkktilcfgealidmlaqplvkkgmpraflqcaggapanvavavarlggavqfvgmlgs dmfgdflfdsfaeagvvtdgivrtstaktalafvaldahgersfsfyrppaadllfrvehfqdasfsda lifhacsnsmtdadiaevtfegmrraqaagaivsfdlnfrpmlwpngenpasrlwkglsladvvklsse eldylantlaadanaviqqlwqgraqlllvtdaagpvhwytrtaggevptfrvqvqdsnaagdafvggm lytfaqqfddaaalidfchdpesivstlrfaaavgalavtrqgaftampmlsevlsliqeqs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.04 Rfree 0.222
    Matthews' coefficent 3.97 Rfactor 0.213
    Waters 291 Solvent Content 69.02

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;ATP (ADENOSINE-5'-TRIPHOSPHATE) x 1
    Metals K (POTASSIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch