.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lme

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of probable translation initiation inhibitor from (RPA2473) from Rhodopseudomonas palustris. To be published
    Site NYSGXRC
    PDB Id 3lme Target Id NYSGXRC-11275c
    Molecular Characteristics
    Source Rhodopseudomonas palustris
    Alias Ids TPS33400,PF01042, 3.30.1330.40, CAE27914.1 Molecular Weight 16491.01 Da.
    Residues 157 Isoelectric Point 7.96
    Sequence mtnslrtllaaaaiavavpalaaaetsavkiiaptdktitpsgtwsigaragdfvfiggmrgtdrvtgk mvdgdearirrmfdnmlaaaeaagatkadavrltvfvtdvakyrpvvnkvqkdiwgdgpypprtvlqvp aldqgdiaeidgtfyapak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 2.74 Rfree 0.246
    Matthews' coefficent 3.28 Rfactor 0.204
    Waters 25 Solvent Content 62.45

    Ligand Information
    Ligands SO4 (SULFATE) x 14
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch