.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lnv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of fatty acyl-adenylate ligase from L. pneumophila in complex with acyl adenylate and pyrophosphate. To be Published
    Site NYSGXRC
    PDB Id 3lnv Target Id NYSGXRC-11191l
    Related PDB Ids 3kxw 3ll3 
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS31643,AAU28294.1, 3.30.300.30, PF00501 Molecular Weight 66002.47 Da.
    Residues 581 Isoelectric Point 6.33
    Sequence vkkeylqcqslvdvvrlralhspnkksctflnkeleetmtyeqldqhakaiaatlqaegakpgdrvlll fapglpliqaflgclyagciavpiyppaqeklldkaqrivtnskpvivlmiadhikkftadelntnpkf lkipaialesielnrssswqptsiksndiaflqytsgstmhpkgvmvshhnlldnlnkiftsfhmndet iifswlpphhdmgligciltpiyggiqaimmspfsflqnplswlkhitkykatisgspnfaydycvkri reekkegldlsswvtafngaepvreetmehfyqafkefgfrkeafypcyglaeatllvtggtpgssykt ltlakeqfqdhrvhfaddnspgsyklvssgnpiqevkiidpdtlipcdfdqvgeiwvqsnsvakgywnq peetrhafagkikddersaiylrtgdlgflhenelyvtgrikdliiiygknhypqdiefslmhsplhhv lgkcaafviqeeheykltvmcevknrfmddvaqdnlfneifelvyenhqlevhtivliplkamphttsg kirrnfcrkhlldktlpivatwqlnkiee
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.2443
    Matthews' coefficent 2.19 Rfactor 0.1934
    Waters 388 Solvent Content 43.91

    Ligand Information
    Ligands 1ZZ (5'-O-[(S)-(DODECANOYLOXY)(HYDROXY)PHOSPHORYL]ADENOSINE) x 1;POP (PYROPHOSPHATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3lnv
    1. Structural and Functional Studies of Fatty Acyl Adenylate Ligases from E. coli and L. pneumophila
    Z Zhang, R Zhou, JM Sauder, PJ Tonge - Journal of Molecular , 2011 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch