.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lop

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of substrate-binding periplasmic protein (Pbp) from Ralstonia solanacearum. To be Published
    Site NYSGXRC
    PDB Id 3lop Target Id NYSGXRC-11232b
    Molecular Characteristics
    Source Ralstonia solanacearum
    Alias Ids TPS33398,3.40.50.2300, PF01094, NP_521182.1 Molecular Weight 40853.65 Da.
    Residues 388 Isoelectric Point 9.45
    Sequence mqmgnhtrsrrgtrlrrlaavafalcaglaasvaqadisviqslplsgsqavtghalnagarlyfdwln lnggihgetvrlvarddeqkveqtvrnvrdmakvdnpvalltvvgtanvealmregvlaearlplvgpa tgassmtgdplvfpikasyrqeidkmitalvtigitrigvlyqddalgkeaiagvertlkahglpiaam asyprntasvgpavdkllaadvqaiflgataapagqfvrqyrergggaqllglssidpgilqkiaglda vrgyslalvmpnpgksvhpvirefnraraavgatdvelsfravegfvaakvlaeairragpkptreqvq halaglhdydvgggftvdftdrsrpgshyvelgvvgpnglviq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.55 Rfree 0.195
    Matthews' coefficent 2.08 Rfactor 0.179
    Waters 443 Solvent Content 40.78

    Ligand Information
    Ligands LEU (1,2-ETHANEDIOL) x 1;EDO x 5
    Metals MN (MANGANESE) x 1;NI (NICKEL) x 2;MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3lop
    1. Characterization of transport proteins for aromatic compounds derived from lignin: benzoate derivative binding proteins
    K Michalska, C Chang, JC Mack, S Zerbs - Journal of Molecular , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch