.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lq7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Glutathione S-Transferase from Agrobacterium Tumefaciens. To be Published
    Site NYSGXRC
    PDB Id 3lq7 Target Id NYSGXRC-21009a
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS33350,15891246, PF02798 Molecular Weight 26138.54 Da.
    Residues 230 Isoelectric Point 6.33
    Sequence msnietvpasiemkpnptitvferspdggrglardmpvrwaleevgqpyhvrrlsfeamkeashlayqp fgqipsyeqgdlilfesgaivmhiaqhhsgllpedqlrrartvawmfaalntiepsilnfttvwlfern epwhearlartkeqllkrldelsawlgdrewlegsfsaadilmicvlrrlessgilkdygnllayverg karpafkrafdaqlavftaaskn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.30 Rfree 0.28815
    Matthews' coefficent 2.30 Rfactor 0.24304
    Waters 44 Solvent Content 46.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch