.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lsz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutathione s-transferase from Rhodobacter sphaeroides. To be Published
    Site NYSGXRC
    PDB Id 3lsz Target Id NYSGXRC-21013b
    Molecular Characteristics
    Source Rhodobacter sphaeroides
    Alias Ids TPS33353,77464345, PF02798 Molecular Weight 23949.11 Da.
    Residues 219 Isoelectric Point 5.73
    Sequence mlkiygvyrsrasrplwllaeldlpfehvpviqanrvahphgpeaplntasaaylavnplgqipcleee glilteslaitlhiartqggqlgprsepedalmvswslfaataveppaleiqliqrsgggtspegqaai aiaaerlrrplarlerhfaaedylvggrftvadlnlaetlrygqahpallepfpavaawldrcqsrpaf rlmmerraaepe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.2261
    Matthews' coefficent 2.30 Rfactor 0.2061
    Waters 414 Solvent Content 46.58

    Ligand Information
    Ligands GSH (GLUTATHIONE) x 4;TRS (2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL) x 4;GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3lsz
    1. A Glutathione Transferase from Agrobacterium tumefaciens Reveals a Novel Class of Bacterial GST Superfamily
    K Skopelitou, P Dhavala, AC Papageorgiou - PloS one, 2012 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch