.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lto

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a mevalonate diphosphate decarboxylase from Legionella pneumophila. To be Published
    Site NYSGXRC
    PDB Id 3lto Target Id NYSGXRC-11277d
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS33401,AAU28109.1, 3.30.230.10, PF00288 Molecular Weight 36375.45 Da.
    Residues 322 Isoelectric Point 6.87
    Sequence ltsrrltmhwfaqapanialikymgkkdensnlpdnsslsytlsnllssvkleklptkkdiwepltipg apefnlsveaqkrfidhlvrlkeyfgyvggfliqssnnfphssglassassfaaltkcasialseltqk plpsideqaqlsrlgsgsscrsfyapwalwtgdkvsaidlpykdllhqvivissqekeipsrvahklvk tspfyetrseraeanlklllnafenkdwtsiyqicwhefldmhqlfktcekpfsyitdntlhilsviek fwnekgdgpvvtmdagpnvhllyrsdqtdlarqfksdhlvgnydvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.27 Rfree 0.257
    Matthews' coefficent 2.20 Rfactor 0.211
    Waters 235 Solvent Content 44.02

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 3lto
    1. Crystal structures of staphylococcus epidermidis mevalonate diphosphate decarboxylase bound to inhibitory analogs reveal new insight into substrate binding and
    ML Barta, DA Skaff, WJ McWhorter - Journal of Biological , 2011 - ASBMB
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch