.
The Open Protein Structure Annotation Network
PDB Keyword
.

3lxz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of probable Glutathione S-transferase(PP0183) from Pseudomonas putida. To be published
    Site NYSGXRC
    PDB Id 3lxz Target Id NYSGXRC-21012b
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS33352,26986927, PF02798 Molecular Weight 24437.17 Da.
    Residues 220 Isoelectric Point 5.57
    Sequence mlklygfsvsnyynmvklallekgltfeevtfyggqapqalevsprgkvpvletehgflsetsvildyi eqtqggkallpadpfgqakvrellkeielyielpartcyaesffgmsveplikekaradllagfatlkr ngrfapyvageqltladlmfcfsvdlanavgkkvlnidfladfpqakallqlmgenphmpriladkeas mpafmemirsgkr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.76 Rfree 0.229
    Matthews' coefficent 2.71 Rfactor 0.196
    Waters 653 Solvent Content 54.55

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch