.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m2p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of UDP-N-acetylglucosamine 4-epimerase from Bacillus cereus. To be Published
    Site NYSGXRC
    PDB Id 3m2p Target Id NYSGXRC-11155j
    Molecular Characteristics
    Source Bacillus cereus
    Alias Ids TPS33365,3.40.50.720, NP_834934.1 Molecular Weight 33802.13 Da.
    Residues 301 Isoelectric Point 5.40
    Sequence mkiavtggtgflgqyvvesikndgntpiiltrsignkaindyeyrvsdytledlinqlndvdavvhlaa trgsqgkisefhdneiltqnlydacyennisnivyastisaysdetslpwnekelplpdlmygvsklac ehigniysrkkglciknlrfahlygfneknnyminrffrqafhgeqltlhansvakreflyakdaaksv iyalkqekvsgtfnigsgdaltnyevantinnafgnkdnllvknpnanegihssymdsskakelldfst dynfataveeihllmrglddvplwy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.2757
    Matthews' coefficent 3.06 Rfactor 0.2116
    Waters 114 Solvent Content 59.82

    Ligand Information
    Ligands UDP (URIDINE-5'-DIPHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch