.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m3p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glutamine amido transferase from Methylobacillus Flagellatus. To be Published
    Site NYSGXRC
    PDB Id 3m3p Target Id NYSGXRC-11175j
    Molecular Characteristics
    Source Methylobacillus flagellatus
    Alias Ids TPS31640,YP_544549.1, 3.40.50.880 Molecular Weight 26980.53 Da.
    Residues 241 Isoelectric Point 5.11
    Sequence mkpvmiiqfsasegpghfgdflagehipfqvlrmdrsdplpaeirdcsglammggpmsanddlpwmptl lalirdavaqrvpvighclggqllakamggevtdsphaeigwvrawpqhvpqalewlgtwdelelfewh yqtfsippgavhilrsehcanqayvlddlhigfqchiemqahmvrewcsispeelkggaeadpaqpmvq saveilrdldvriatlnrwaehvyarwikglqrd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.15545
    Matthews' coefficent 2.16 Rfactor 0.12381
    Waters 506 Solvent Content 43.08

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch