.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m7v

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of phosphopentomutase from streptococcus mutans. To be Published
    Site NYSGXRC
    PDB Id 3m7v Target Id NYSGXRC-6197f
    Molecular Characteristics
    Source Streptococcus mutans
    Alias Ids TPS7751,PF01676, NP_721612.1 Molecular Weight 43953.20 Da.
    Residues 403 Isoelectric Point 5.35
    Sequence mstfnrihlvvldsvgigaapdannfsnagvpdgasdtlghisktvglnvpnmakiglgniprdtplkt vpaenhptgyvtkleevslgkdtmtghweimglnitepfdtfwngfpeeiiskiekfsgrkvireankp ysgtaviddfgprqmetgeliiytsadpvlqiaahedvipldelyriceyarsitlerpallgriiarp yvgkprnftrtanrhdyalspfaptvlnkladagvstyavgkindifngsgitndmghnksnshgvdtl iktmglsaftkgfsftnlvdfdalyghrrnahgyrdclhefderlpeiiaamkvddlllitadhgndpt yagtdhtreyvpllayspsftgngvlpvghyadisatiadnfgvdtamigesfldkli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.21080
    Matthews' coefficent 2.54 Rfactor 0.18063
    Waters 315 Solvent Content 51.64

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MN (MANGANESE) x 4

    Jmol

     
    Google Scholar output for 3m7v
    1. X-Ray Structure Reveals a New Class and Provides Insight into Evolution of Alkaline Phosphatases
    SC Bihani, A Das, KS Nilgiriwala, V Prashar, M Pirocchi - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch