.
The Open Protein Structure Annotation Network
PDB Keyword
.

3m9u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Geranylgeranyl Pyrophosphate Synthase from Lactobacillus Brevis Atcc 367. To be Published
    Site NYSGXRC
    PDB Id 3m9u Target Id NYSGXRC-20032b
    Molecular Characteristics
    Source Lactobacillus brevis
    Alias Ids TPS33348,116333612, PF00348 Molecular Weight 32231.03 Da.
    Residues 300 Isoelectric Point 5.40
    Sequence mpinarliafedqwvpalnaplkqailadshdaqlaaamtysvlaggkrlrplltvatmrslgvtfvpe rhwrpvmalellhtyslihddlpamdndalrrgeptnhvkfgagmatlagdglltlafqwltatdlpat mqaalvqalataagpsgmvagqakdiqsehvnlplsqlrvlhkektgallhyavqaglilgqapeaqwp aylqfadafglafqiyddildvvsspaemgkatqkdadeakntypgklgliganqalidtihsgqaalq glptstqrddlaaffsyfdtervn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.77 Rfree 0.19626
    Matthews' coefficent 2.25 Rfactor 0.15819
    Waters 708 Solvent Content 45.42

    Ligand Information
    Ligands GOL (GLYCEROL) x 22
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch