.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mc1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a predicted phosphatase from Clostridium acetobutylicum. To be Published 2010
    Site NYSGXRC
    PDB Id 3mc1 Target Id NYSGXRC-22227a
    Molecular Characteristics
    Source Clostridium acetobutylicum
    Alias Ids TPS53328,15893709, PF00702 Molecular Weight 24420.34 Da.
    Residues 216 Isoelectric Point 4.82
    Sequence lynyvlfdldgtltdsaegitksvkyslnkfdiqvedlsslnkfvgpplktsfmeyynfdeetatvaid yyrdyfkakgmfenkvydgieallsslkdygfhlvvatskptvfskqilehfklafyfdaivgssldgk lstkedviryameslniksddaimigdreydvigalknnlpsigvtygfgsyeelknaganyivnsvde lhkkilelr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.93 Rfree 0.272
    Matthews' coefficent 2.10 Rfactor 0.224
    Waters 103 Solvent Content 41.50

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals NA (SODIUM) x 2;CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch