.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mdk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of stringent starvation protein A (sspA) from Pseudomonas putida. To be published
    Site NYSGXRC
    PDB Id 3mdk Target Id NYSGXRC-21019d
    Molecular Characteristics
    Source Pseudomonas putida
    Alias Ids TPS53308,26988055, PF02798 Molecular Weight 23564.89 Da.
    Residues 207 Isoelectric Point 5.98
    Sequence mgatnrlacysdpadhyshrvrlvlaekgvsvqlidvdpahlprklaevnpygsvptlvdrdlalyest vvmeyleeryphpplmpvypvargnsrllmhriqrdwcaladtvldprsseaartearkalresltgvs plfsefacfmsdeqslvdccllpilwrlpvlgielprqakplldymerqfarepfqaslssveremrkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.85 Rfree 0.258
    Matthews' coefficent 2.29 Rfactor 0.216
    Waters 75 Solvent Content 46.38

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch