.
The Open Protein Structure Annotation Network
PDB Keyword
.

3me7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative electron transport protein aq_2194 from Aquifex aeolicus VF5. To be Published
    Site NYSGXRC
    PDB Id 3me7 Target Id NYSGXRC-11213h
    Related PDB Ids 3me8 
    Molecular Characteristics
    Source Aquifex aeolicus
    Alias Ids TPS53600,PF08534, NP_214507.1, 3.40.30.10 Molecular Weight 26174.43 Da.
    Residues 232 Isoelectric Point 9.33
    Sequence mkllfsflflitfllaqtgstgippneaktlgtyvpgditlvdsygnefqlknlkgkpiilspiythcr aacplitksllkvipklgtpgkdfwvitftfdpkdtledikrfqkeygidgkgwkvvkaktsedlfkll daidfrfmtagndfihpnvvvvlspelqikdyiygvnynylefvnalrlargetalpegfrsylfiigm vglvgtsvyimyllnrilqkrkkaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.219
    Matthews' coefficent 2.21 Rfactor 0.182
    Waters 365 Solvent Content 44.41

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch