.
The Open Protein Structure Annotation Network
PDB Keyword
.

3mpo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a hydrolase from Lactobacillus brevis. To be Published
    Site NYSGXRC
    PDB Id 3mpo Target Id NYSGXRC-22105b
    Molecular Characteristics
    Source Lactobacillus brevis
    Alias Ids TPS53323,PF08282, 116333143 Molecular Weight 29804.25 Da.
    Residues 271 Isoelectric Point 4.66
    Sequence mtikliaididgtllneknelaqatidavqaakaqgikvvlctgrpltgvqpyldamdidgddqyaitf ngsvaqtisgkvltnhsltyedyidleawarkvrahfqietpdyiytankdisaytiaesylvrmliqy revsetprdltiskamfvdypqvieqvkanmpqdfkdrfsvvqsapyfievmnrraskggtlselvdql gltaddvmtlgdqgndltmikyaglgvamgnaidevkeaaqavtltnaengvaaairkyalnek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.90 Rfree 0.2828
    Matthews' coefficent 2.53 Rfactor 0.2263
    Waters 115 Solvent Content 51.36

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3mpo
    1. Evolution of structure and function among hotdog-fold thioesterases and HAD family phosphatases
    W Min - 2012 - repository.unm.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch