.
The Open Protein Structure Annotation Network
PDB Keyword
.

3msr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of an amidohydrolase from Mycoplasma synoviae. To be Published
    Site NYSGXRC
    PDB Id 3msr Target Id NYSGXRC-9686b
    Related PDB Ids 3ovg 
    Molecular Characteristics
    Source Mycoplasma synoviae 53
    Alias Ids TPS53235,PF02126, 71894050 Molecular Weight 39496.71 Da.
    Residues 353 Isoelectric Point 7.64
    Sequence menkfartvlgdipveklgitdchdhfiknggpeveehidflmlnvdasikefkefidrggstivtmdp pnvgrdvlktleianavknlggnvimstgfhkakfydkysswlavvpteeivkmcvaeieegmdeynyn gpvvkrskakagiikagtgygaidrlelkalevaartsiltgcpilvhtqlgtmalevakhligfganp dkiqishlnknpdkyyyekviketgvtlcfdgpdrvkyypdsllaenikylvdkglqkhitlsldagri lyqrnygltkgkqtfglaylfdrflpllkqvgvskeaifdilvnnpkrvlafdekrnfdplkvskevle lkkelnln
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.16 Rfree 0.1920
    Matthews' coefficent 3.01 Rfactor 0.1503
    Waters 295 Solvent Content 59.08

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;PO4 (PHOSPHATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch