.
The Open Protein Structure Annotation Network
PDB Keyword
.

3my9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a muconate cycloisomerase from Azorhizobium caulinodans. To be Published
    Site NYSGXRC
    PDB Id 3my9 Target Id NYSGXRC-9464a
    Molecular Characteristics
    Source Azorhizobium caulinodans ors 571
    Alias Ids TPS52446,158422443, PF01188 Molecular Weight 40489.84 Da.
    Residues 376 Isoelectric Point 5.51
    Sequence mswdsvveririflvespikmarlqgvgnvkgsvkrvllevtsadgivgwgeaapwevftgtpeaafsa ldiylrplilgapikrvrelmarmdkmlvghgeakaavemalldilgkatglsvadllggrvrdripls fsiadpdfdadlermramvpaghtvfkmktgvkphaeelriletmrgefgeridlrldfnqaltpfgam kilrdvdafrptfieqpvprrhldamagfaaaldtpiladescfdavdlmevvrrqaadaisvkimkcg glmkaqslmaiadtaglpgyggtlweggialaagtqliaatpgislgcefymphhvltedvleerians aghvivpdgpglgisiseaslrgnakilaer
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.254
    Matthews' coefficent 2.47 Rfactor 0.202
    Waters 54 Solvent Content 50.24

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch