.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n1u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of putative HAD superfamily (subfamily III A) hydrolase from Legionella pneumophila. To be published
    Site NYSGXRC
    PDB Id 3n1u Target Id NYSGXRC-22264a
    Molecular Characteristics
    Source Legionella pneumophila
    Alias Ids TPS53330,52841075 Molecular Weight 20244.18 Da.
    Residues 183 Isoelectric Point 5.31
    Sequence vffnteiemnellekakkikclicdvdgvlsdgllhidnhgnelksfhvqdgmglkllmaagiqvaiit taqnavvdhrmeqlgithyykgqvdkrsayqhlkktlglnddefayigddlpdlpliqqvglgvavsna vpqvlefadwrtertggrgavrelcdlilnaqnkaelaitgylkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.217
    Matthews' coefficent 2.49 Rfactor 0.176
    Waters 73 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 2

    Jmol

     
    Google Scholar output for 3n1u
    1. The IntFOLD server: an integrated web resource for protein fold recognition, 3D model quality assessment, intrinsic disorder prediction, domain prediction and ligand
    DB Roche, MT Buenavista, SJ Tetchner - Nucleic acids , 2011 - Oxford Univ Press
     
    2. Assessment of ligand_binding residue predictions in CASP9
    T Schmidt, J Haas, TG Cassarino - Structure, Function, and , 2011 - Wiley Online Library
     
    3. FunFOLD: an improved automated method for the prediction of ligand binding residues using 3D models of proteins
    D Roche, S Tetchner, L McGuffin - BMC bioinformatics, 2011 - biomedcentral.com
     
    4. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch