.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n28

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Phosphoserine Phosphatase from Vibrio Cholerae. To be Published
    Site NYSGXRC
    PDB Id 3n28 Target Id NYSGXRC-22067a
    Molecular Characteristics
    Source Vibrio cholerae
    Alias Ids TPS53321,PF00702, 15642342 Molecular Weight 36081.64 Da.
    Residues 328 Isoelectric Point 4.98
    Sequence vdmdalttlpikkhtallnrfpetrfvtqlakkraswivfghyltpaqfedmdfftnrfnaildmwkvg ryevalmdgeltsehetilkaleldyariqdvpdltkpglivldmdstaiqiecideiaklagvgeeva evteramqgeldfeqslrlrvsklkdapeqilsqvretlplmpelpelvatlhafgwkvaiasggftyf sdylkeqlsldyaqsntleivsgkltgqvlgevvsaqtkadilltlaqqydveihntvavgdgandlvm maaaglgvayhakpkveakaqtavrfaglggvvcilsaalvaqqklswkskp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.25260
    Matthews' coefficent 3.87 Rfactor 0.20068
    Waters 49 Solvent Content 68.21

    Ligand Information
    Ligands SO4 (SULFATE) x 6
    Metals

    Jmol

     
    Google Scholar output for 3n28
    1. SAD phasing using iodide ions in a high-throughput structural genomics environment
    J Abendroth, AS Gardberg, JI Robinson - Journal of structural and , 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch