.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n53

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a response regulator receiver modulated diguanylate cyclase from Pelobacter carbinolicus. To be Published
    Site NYSGXRC
    PDB Id 3n53 Target Id NYSGXRC-11022v
    Molecular Characteristics
    Source Pelobacter carbinolicus
    Alias Ids TPS53392,3.40.50.2300, Q3A6W4_PELCD, PF00072 Molecular Weight 53480.69 Da.
    Residues 470 Isoelectric Point 6.30
    Sequence mkkiliidqqdfsrielknfldseylviesknekealeqidhhhpdlvildmdiigenspnlclklkrs kglknvplillfssehkeaivnglhsgaddyltkpfnrndllsrieihlrtqnyysdlrkndllmllel tetisvtrnprrilsiiverliktidvsrcsiigindfgellvlassdlpenqeikldlkkypeiekal etqrpvvlqditnsalmkpvkkhiealsdnavfvvpiikkqnvigtfflrtaclqkggitdrifklcqv iasisgnalenaiifesmetnkklledlsvrdsltklynhqhyhsrledefsraqrynldlscifldid nfknindryghlagdmvlrqiarlisqvirksdisaryggeefaiclpntggvaanelaerllvmirel siqqlkgehvtvsigtstysnhnvasysellhladdamyeakksgknrfccstamf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.20 Rfree 0.286
    Matthews' coefficent 2.05 Rfactor 0.252
    Waters 44 Solvent Content 39.91

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3n53
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch