.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n6j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Mandelate racemase/muconate lactonizing protein from Actinobacillus succinogenes 130Z. To be Published
    Site NYSGXRC
    PDB Id 3n6j Target Id NYSGXRC-9499d
    Related PDB Ids 3n6h 
    Molecular Characteristics
    Source Actinobacillus succinogenes
    Alias Ids TPS53201,152979509, PF01188 Molecular Weight 49334.77 Da.
    Residues 445 Isoelectric Point 5.76
    Sequence mstqsvpvitdmkvipvaghdsmlmnvggahspyftrniviltdnsghtgvgeapggatienalteaip hvvgrpisilnkivndmhngyldadydtfgkgawtfelrvnavaaleaalldlmgqflgvpvaellgpg kqrdevtvlgylfyvgddkitdlpyqqpvtgkhewydirrkkamdtqavielaaaskdrygfkdfklkg gvfegskeidtvielkkhfpdaritldpngcwsldeaiqlckglndvltyaedpcigengysgreimae frrrtgiptatnmiatnwremchaimlqsvdipladphfwtltgasrvaqlcnewgltwgchsnnhfdi slamfshvgaaapgnptaldthwiwqegdfyltknpleikdgkiklndkpglgielnmdnvlkahelhk klpngarndaipmqfyypgwkfdrkrpamvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.40 Rfree 0.30389
    Matthews' coefficent 2.10 Rfactor 0.21721
    Waters 346 Solvent Content 41.33

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch