.
The Open Protein Structure Annotation Network
PDB Keyword
.

3n7c

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the RAN binding domain from the nuclear pore complex component NUP2 from Ashbya gossypii. To be Published
    Site NYSGXRC
    PDB Id 3n7c Target Id NYSGXRC-15002c
    Related PDB Ids 3oan 
    Molecular Characteristics
    Source Ashbya gossypii
    Alias Ids TPS53264,PF00638, 45185263 Molecular Weight 65478.72 Da.
    Residues 615 Isoelectric Point 6.36
    Sequence makrfagsqitretyeqsasdsegetgsgpklasaltmqkrkiampkrktssasggagfgnafafvkra gaapgaeeaapapatapagdqqaklqalnmqlhekvmhavredpfvnltpalekykkylssigvlsvgm eeeregkyatvikhdvgmacaggakqaeeddsdamsedevkpvkvegpkfvlaqgpttknpvfsfgtkk qqkkedsdsedeievkgptftvsgnvssgifklnkdsaenkaeqsapifstksdeksssaavtafggaa aqeaslngttptkpvftfgvpsdkkpeaakpsfsfgfsastqadktekaekpvfsfgvsanqqndkedk prftfgtaaeknvenskptfgaptsdakqgvtskpafqfgtgttntaatpfgvklpvadqskqqnkpls fsfgsstaflgtflllwsetsgcfpssragglsrfslpfaqdsktlttenieqtgteeataahegandq aqtgepesegikmtngeeneevlfcekakllifdsdtkgytsrgvgelkllrkkddkgkvrvlcrsegm ghvllntsvvksfkyqpidadnenlikwpiitdgkletfiikvkqkadgrrlvgavadaqqam
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.26 Rfree 0.293
    Matthews' coefficent 2.31 Rfactor 0.234
    Waters 27 Solvent Content 46.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch