.
The Open Protein Structure Annotation Network
PDB Keyword
.

3neh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the protein LMO2462 from Listeria monocytogenes complexed with ZN and phosphonate mimic of dipeptide L-Leu-D-Ala. To be Published
    Site NYSGXRC
    PDB Id 3neh Target Id NYSGXRC-9513a
    Molecular Characteristics
    Source Listeria monocytogenes
    Alias Ids TPS53224,PF01244, 16411950 Molecular Weight 34756.93 Da.
    Residues 308 Isoelectric Point 5.51
    Sequence mrvidthcdalyklqagkgkytfqdaeeldvnferlieakmllqgfaifldedipvehkwkkaveqvni fkqhvlhkggiihhvkkwcdlenlpedkigamltlegiepigrdldkltqlldggvlsvgltwnnanla adgimeergagltrfgkdiihllnerkvftdvshlsvkafwetleqaefviashssakaicahprnldd eqikamiehdamihvifhplfttndgvadiedvirhidhicelggmknigfgsdfdgipdhvkglehag kyqnfletlgkhytkeevegfasrnflnhlpk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.64 Rfree 0.2193
    Matthews' coefficent 2.25 Rfactor 0.1967
    Waters 354 Solvent Content 45.31

    Ligand Information
    Ligands L3A ((2R)-3-[(R)-[(1R)-1-AMINO-3-METHYLBUTYL](HYDROXY)) x 2
    Metals ZN (ZINC) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch