The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a response regulator from Myxococcus xanthus. To be Published
    Site NYSGXRC
    PDB Id 3nhm Target Id NYSGXRC-11022m
    Molecular Characteristics
    Source Myxococcus xanthus
    Alias Ids TPS53337,, Q1CZZ7_MYXXD, PF00072 Molecular Weight 16302.93 Da.
    Residues 153 Isoelectric Point 6.20
    Sequence vhrappggclpesrgvvkpkvlivenswtmretlrlllsgefdcttaadgasglqqalahppdvlisdv nmdgmdgyalcghfrseptlkhipvifvsgyaprtegpadqpvpdaylvkpvkppvliaqlhallarae avtpaaptiqpawks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.263
    Matthews' coefficent 1.89 Rfactor 0.230
    Waters 137 Solvent Content 35.09

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch