.
The Open Protein Structure Annotation Network
PDB Keyword
.

3no1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Mandelate racemase/muconate lactonizing enzyme from a Marine actinobacterium in complex with magnesium. To be Published
    Site NYSGXRC
    PDB Id 3no1 Target Id NYSGXRC-9813b
    Related PDB Ids 3msy 
    Molecular Characteristics
    Source Marine actinobacterium
    Alias Ids TPS53251,88854861, PF01188 Molecular Weight 43436.60 Da.
    Residues 388 Isoelectric Point 5.29
    Sequence mhdqrvhaerdpldpqahgltitrietipmvaplarefrgshyhmthrativtrvhtdagiigeaytgd ehetmfdidriiheelaptligqdamaierlwdsgykvtfdilrdrrlglvalaavntaiwdavgkalk mplwklwggyrnelpmiaiggyygeplgsiademhnyqelglagvkfkvgglsaaedaaritaareaag ddfiicidanqgykpavavdlsrriadlnirwfeepvewhndkrsmrdvryqgsvpvcagqtefsasgc rdlmetgaidvcnfdsswsggptawlrtaaiatsydvqmghheepqvsthllasqphgtiaecfhpdrd pfwwnmitnrpklnngtltlsdrpglgwdlnwdyidqyrvskd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.16 Rfree 0.240
    Matthews' coefficent 2.13 Rfactor 0.207
    Waters 626 Solvent Content 42.38

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch