.
The Open Protein Structure Annotation Network
PDB Keyword
.

3npk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of geranyltranstransferase from Campylobacter jejuni. To be Published
    Site NYSGXRC
    PDB Id 3npk Target Id NYSGXRC-20095a
    Molecular Characteristics
    Source Campylobacter jejuni
    Alias Ids TPS53288,PF00348, 57238655 Molecular Weight 31717.91 Da.
    Residues 281 Isoelectric Point 5.54
    Sequence vnlkelfihhleknlpkvesfhpffnealalmlkaggkhfraqlllsvvqsnkpellnqaldvalalef ihtyslihddlpamdnadfrrgiptlhksydettailvgdalnteaflvlshahlkdeikikliktlaf naglngmvigqaidcffedkrlslneleflhthktarliaaalkmgceicelnneesnqiyklglklgl ifqinddiidvttsqeqsgkptnndihknsfvnllgleqaiktkenllneceqdleklneklaqmiqnl iiqyl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.50 Rfree 0.1851
    Matthews' coefficent 2.40 Rfactor 0.1564
    Waters 497 Solvent Content 48.83

    Ligand Information
    Ligands PPV (PYROPHOSPHATE) x 2;GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch