.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Adenine Deaminase from Agrobacterium tumefaciens (str. C 58). To be Published
    Site NYSGXRC
    PDB Id 3nqb Target Id NYSGXRC-9206a
    Molecular Characteristics
    Source Agrobacterium tumefaciens
    Alias Ids TPS48725,15890557, PF01979 Molecular Weight 62807.35 Da.
    Residues 597 Isoelectric Point 5.31
    Sequence mtaqirlaepadlnddtlraravaaargdqrfdvlitggtlvdvvtgelrpadigivgaliasvhepas rrdaaqvidaggayvspglidthmhiessmitpaayaaavvargvttivwdphefgnvhgvdgvrwaak aienlplraillapscvpsapglerggadfdaailadllswpeiggiaeimnmrgvierdprmsgivqa glaaeklvcgharglknadlnafmaagvssdhelvsgedlmaklragltielrgshdhllpefvaalnt lghlpqtvtlctddvfpddllqggglddvvrrlvryglkpewalraatlnaaqrlgrsdlgliaagrra divvfedlngfsarhvlasgravaeggrmlvdiptcdttvlkgsmklplrmandflvksqgakvrlati drprftqwgeteadvkdgfvvppegatmisvthrhgmaepttktgfltgwgrwngafattvshdshnlt vfggnagdmalaanavigtgggmavasegkvtailplplsglvsdapleevarafedlreavgkvvewq ppylvfkacfgatlacnigphqtdmgiadvltgkvmespvievlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.21 Rfree 0.23462
    Matthews' coefficent 2.20 Rfactor 0.17216
    Waters 380 Solvent Content 44.12

    Ligand Information
    Ligands
    Metals MN (MANGANESE) x 6

    Jmol

     
    Google Scholar output for 3nqb
    1. Enzymatic deamination of the epigenetic base N-6-methyladenine
    SS Kamat, H Fan, JM Sauder, SK Burley - Journal of the , 2011 - ACS Publications
     
    2. Catalytic mechanism and three-dimensional structure of adenine deaminase
    SS Kamat, A Bagaria, D Kumaran - Biochemistry, 2011 - ACS Publications
     
    3. The catalase activity of diiron adenine deaminase
    SS Kamat, GP Holmes_Hampton, A Bagaria - Protein , 2011 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch