.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nvb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of N-terminal part of the protein BF1531 from Bacteroides fragilis containing phosphatase domain complexed with Mg and tungstate. To be Published
    Site NYSGXRC
    PDB Id 3nvb Target Id NYSGXRC-9506a
    Molecular Characteristics
    Source Bacteroides fragilis
    Alias Ids TPS53213,YP_098815 Molecular Weight 66186.68 Da.
    Residues 575 Isoelectric Point 5.08
    Sequence mytfkelkratkqdtvslpklkvallgdtatqllataikgegilrnynielweaeynqverqimdptsd yyqfepdytiifhsthkllekhslvnsdlqnkladdrldfvrllceqgigrviyynypeiedtiwgsya tkvqssftyqltklnyelmnisqaypnfficnlagisakygrnfmfdssvyvnteiilsldalpiissr tidiiaaiqgkfkkclildldntiwggvvgddgweniqvghglgigkaftefqewvkklknrgiiiavc sknnegkakepfernpemvlklddiavfvanwenkadnirtiqrtlnigfdsmvflddnpfernmvreh vpgvtvpelpedpgdyleylytlnlfetasfseddkdrtkqyqieakrvslqqsftneaeflksldmvs evkgfdkfntprvaqlsqrsnqfnlrtvryteaeiaaiesdlhyatfsftladrfgdnglicviilekq dtetlfintwfmscrvlkrgmenftlntlvdyarsngfkrfigeylpsaknqmveehyphlgfskmegg dnaaryvldvetyeekecyitkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.71 Rfree 0.2091
    Matthews' coefficent 2.22 Rfactor 0.1825
    Waters 270 Solvent Content 44.59

    Ligand Information
    Ligands WO4 (TUNGSTATE(VI)ION) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch