.
The Open Protein Structure Annotation Network
PDB Keyword
.

3nxl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Glucarate dehydratase from Burkholderia cepacia complexed with magnesium. To be Published
    Site NYSGXRC
    PDB Id 3nxl Target Id NYSGXRC-9499i
    Molecular Characteristics
    Source Burkholderia cepacia
    Alias Ids TPS53207,46310938, PF01188 Molecular Weight 52321.29 Da.
    Residues 487 Isoelectric Point 5.72
    Sequence mngagrtgaaggpcitgtrsepmsesrrdgtprvtrmqvipvagrdsmllnlcgahapyftrnlvildd ssghtgvgevpggegirhalermtdlvvgqsigryqatlnavraalsgagpgagrtirhevtsageaav lrqpheinlrldnvitaieaalldllgqhldvpvaallgegqqrdavpmlaylfyigdrgrtdlpyrde aqartpwfrlrneealtpaaiarqaeaavdrygfadfklkggvmagademeaiaaikacfpdaratldp ngawsldeavalcrgqghllayaedpcgpeggysgrevmaefrratgiptatnmiatdwrqmdhavrlq avdipladphfwtmqgsvrlaqlcrdwgltwgshsnnhfdvslamfthaaaaapgtitaidthwiwqeg darltreplkivggqvavperpglgieldmaqveaahalykevggtarddavamrylvpgwtydpkrpsfgrg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.89 Rfree 0.2207
    Matthews' coefficent 2.61 Rfactor 0.1901
    Waters 880 Solvent Content 52.84

    Ligand Information
    Ligands CO3 (CARBONATE) x 4
    Metals MG (MAGNESIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch