.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oc4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NYSGXRC
    PDB Id 3oc4 Target Id NYSGXRC-11133h
    Molecular Characteristics
    Source Enterococcus faecalis
    Alias Ids TPS53458,3.40.50.720, AAO81682.1 Molecular Weight 49449.03 Da.
    Residues 444 Isoelectric Point 5.30
    Sequence mkiviigasfagisaaiasrkkypqaeislidkqatvgylsgglsayfnhtinelhearyiteeelrrq kiqlllnrevvamdvenqliawtrkeeqqwysydklilatgasqfstqirgsqtekllkykflsgalaa vpllensqtvavigagpigmeaidflvkmkktvhvfeslenllpkyfdkemvaevqkslekqavifhfe etvlgieetangivletseqeiscdsgifalnlhpqlayldkkiqrnldqtiavdaylqtsvpnvfaig dcisvmnepvaetfyaplvnnavrtglvvannleekthrfigslrtmgtkvgdyylastglteteglff pqtlasiivrqpapplqhgteilgkliydkvtqrvlgaqlcsknnclekintlalsiqtgqtltdllqk dyfyqpsltniyditnlmgasaywrendes
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch