.
The Open Protein Structure Annotation Network
PDB Keyword
.

3op2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative mandelate racemase from Bordetella bronchiseptica RB50 complexed with 2-oxoglutarate/phosphate. To be Published
    Site NYSGXRC
    PDB Id 3op2 Target Id NYSGXRC-9280a
    Related PDB Ids 3h12 
    Molecular Characteristics
    Source Bordetella bronchiseptica
    Alias Ids TPS27001,33603659, PF01188 Molecular Weight 42191.62 Da.
    Residues 387 Isoelectric Point 5.87
    Sequence mkitevkahalstpipermrvesgaglklnrqmilvevrtdegvtgvgspsgpydlavlkraiedvigp qligedpaninylwhkvfhgevsrnlghrsvgiaamsgvdialwdlkgramnqpiyqllggkfhtrgvr ayassiywdltpdqaadelagwveqgftaaklkvgraprkdaanlramrqrvgadveilvdanqslgrh dalamlrildeagcywfeeplsiddieghrilraqgtpvriatgenlytrnafndyirndaidvlqada sraggitealaisasaasahlawnphtfndiitvaanlhlvaasphpamfewdithndlmtrlasydlk lenglvqppqgpglgfeidwdfvaahawkgepaigaghgmkk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.2223
    Matthews' coefficent 2.42 Rfactor 0.1834
    Waters 403 Solvent Content 49.22

    Ligand Information
    Ligands AKG (2-OXOGLUTARIC) x 1;PO4 (PHOSPHATE) x 1
    Metals MG (MAGNESIUM) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch