.
The Open Protein Structure Annotation Network
PDB Keyword
.

3opn

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site NYSGXRC
    PDB Id 3opn Target Id NYSGXRC-11117l
    Molecular Characteristics
    Source Lactococcus lactis subsp. lactis
    Alias Ids TPS53397,NP_267014.1, 3.40.50.150 Molecular Weight 26790.42 Da.
    Residues 243 Isoelectric Point 6.03
    Sequence maglvvdsksgerydkpgqkiddgtelrlkgeklryvsrgglklekalkefhleingktcldigsstgg ftdvmlqngaklvyaldvgtnqlawkirsdervvvmeqfnfrnavladfeqgrpsftsidvsfisldli lpplyeilekngevaalikpqfeagreqvgkngiirdpkvhqmtiekvlktatqlgfsvkgltfspikg gagnveflvhllkdgkaeiaqqvniesvlqkeseel
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3opn
    1. Crystal structure of RlmM, the 2_ O-ribose methyltransferase for C2498 of Escherichia coli 23S rRNA
    AS Punekar, TR Shepherd, J Liljeruhm - Nucleic Acids , 2012 - Oxford Univ Press
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch