.
The Open Protein Structure Annotation Network
PDB Keyword
.

3oqb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF putative oxidoreductase from Bradyrhizobium japonicum USDA 110. To be Published
    Site NYSGXRC
    PDB Id 3oqb Target Id NYSGXRC-9479c
    Molecular Characteristics
    Source Bradyrhizobium japonicum usda 110
    Alias Ids TPS53195,PF01408, 27377951 Molecular Weight 43226.02 Da.
    Residues 383 Isoelectric Point 6.72
    Sequence mttqrlglimngvtgrmglnqhlirsivairdqggvrlkngdrimpdpilvgrsaekvealakrfniar wttdldaaladkndtmffdaattqarpglltqainagkhvycekpiatnfeealevvklanskgvkhgt vqdklflpglkkiaflrdsgffgrilsvrgefgywvfeggwqeaqrpswnyrdedgggiildmvchwry vldnlfgnvqsvvcigntdiperfdeqgkkykataddsayatfqleggviahinmswvtrvyrddlvtf qvdgthgsavaglsdcmiqarqatprpvwnpdekrlhdfygdwqklpdnvsydngfkeqwemfirhvye dapykftllegakgvqlaecalkswkerrwidvapika
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.60 Rfree 0.2471
    Matthews' coefficent 2.51 Rfactor 0.1932
    Waters 265 Solvent Content 51.04

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch