.
The Open Protein Structure Annotation Network
PDB Keyword
.

3or5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of thiol:disulfide interchange protein, thioredoxin family protein from Chlorobium tepidum TLS. TO BE PUBLISHED
    Site NYSGXRC
    PDB Id 3or5 Target Id NYSGXRC-11210i
    Molecular Characteristics
    Source Chlorobium tepidum
    Alias Ids TPS53509,PF08534, 3.40.30.10, AAM73449.1 Molecular Weight 18990.10 Da.
    Residues 178 Isoelectric Point 9.74
    Sequence mkrlaspfapfvaalmvfslslafsaqadarptpapsfsgvtvdgkpfssaslkgkayivnffatwcpp crseipdmvqvqktwasrgftfvgiavneqlpnvknymktqgiiypvmmatpelirafngyidggitgi ptsfvidasgnvsgvivgprskadfdrivkmalgakaatk
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree 0.19876
    Matthews' coefficent 2.03 Rfactor 0.17410
    Waters Solvent Content 39.31

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch