.
The Open Protein Structure Annotation Network
PDB Keyword
.

NYSGXRC-11029q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site SGX Pharmaceuticals
    Status Selected
    Target Id NYSGXRC-11029q
    Molecular Characteristics
    Source Candidatus kuenenia
    Alias Ids TPS19961,3.40.50.2300, PF00072, Q1Q7M3_9BACT Molecular Weight 83625.08 Da.
    Residues 736 Isoelectric Point 6.13
    Sequence MNPPPIYQNLTAGNDFHDIHILVVDDDPGMLESVKQLLEIHRYCVTTIKGGSQACRALSATSYDLLLLDLNLNGIS GYDVMNFMNDHSIKTPVIVISGNTSFASVSKAIQRGALDYIKKPYDPEELLVKIKNTTTKIQREVLNIKMQRHLK KSEVLHRYIVNNSPDIICTIDHEGRVMFINTKIENFLGYKPQELIGKLYSEIVSPEDVERLNVFVKEKIRRGSGN YPSDKIEVCLVPKENYFKSRYFELTLFPVELNLLGFQPKNGNISGDKLFGVYAIAHDITERKEAKEYIHFQACHD LLTKLPNRTSFEKRGRLAISKARQNDCIVAVLFLDLDRFKIINDSLGHAVGDQLLQSVTQRLESCLRKCDILSRF GADEFMLLLPEINAPENARQVALKITDIMHTPFVIGDQEIFGDVSIGISFFPEHGETIEQLIQNAEIAMYQAKCR GKKGIQFFDKGMKTSGPHRLAMERDLRRALKNNEFEIVYQPQITINTGKVIGFEALVRWNHPEKGKIRPSEFIPV AEETRLIEDLGEWVLHHACCEVREWIKKGHDTIRLSINISPLQIENPHFVENFVHMLGICQFPGKNMEIELTESI LMTDLEHMAQILNHLHKHSITVAIDDFGIGYSSLSYIQKLPIHTLKIDQSFMQSIQNETDESCLVNAIIAMGKGL HLCTVAEGVETMTQIKYLQNQGCDAVQGYYFGEPRSGEKCLRFLEETTLITTTACFVKAL
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch