.
The Open Protein Structure Annotation Network
PDB Keyword
.

1a5z

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Lactate dehydrogenase from the hyperthermophilic bacterium thermotoga maritima: the crystal structure at 2.1 A resolution reveals strategies for intrinsic protein stabilization. Structure 6 769-781 1998
    Site OTHER
    PDB Id 1a5z Target Id PDB1A5Z
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19955, TM1867 Molecular Weight 34978.50 Da.
    Residues 319 Isoelectric Point 6.67
    Sequence mkigivglgrvgsstafallmkgfaremvlidvdkkraegdaldlihgtpftrraniyagdyadlkgsdv vivaagvpqkpgetrlqllgrnarvmkeiarnvskyapdsivivvtnpvdvltyfflkesgmdprkvfg sgtvldtarlrtliaqhcgfsprsvhvyvigehgdsevpvwsgamiggiplqnmcqvcqkcdskilenf aektkraayeiierkgathyaialavadivesiffdekrvltlsvyledylgvkdlcisvpvtlgkhgv erilelnlneeeleafrksasilknaineitaeenkhqntsg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.286
    Matthews' coefficent 3.80 Rfactor 0.2
    Waters 344 Solvent Content 68.00

    Pathway

    Reactions found in Metabolic Reconstruction for TM1867

    Name: malate dehydrogenase
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : mal-L + nad <==> h + nadh + oaa
    Classification: EC:1.1.1.37
     
    Name: 3-Mercaptolactate:NAD+ oxidoreductase irreversible
    Metabolic Subsystem: Cysteine Metabolism
    Reaction: : h + mercppyr + nadh --> mercplac + nad
    Classification: EC:1.1.1.27
     
    Name: L-lactate dehydrogenase
    Metabolic Subsystem: Pyruvate Met
    Reaction: : lac-L + nad <==> h + nadh + pyr
    Classification: EC:1.1.1.27
     

    Ligand Information
    Ligands FBP (BETA-FRUCTOSE-1,6-DIPHOSPHATE) x 2;OXM (OXAMIC) x 1;NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 1
    Metals CD (CADMIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch