The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cloning, overproduction, purification and crystallization of the DNA binding protein HU from the hyperthermophilic eubacterium Thermotoga maritima. Acta Crystallogr.,Sect.D 54 1043-1045 1998
    Site OTHER
    PDB Id 1b8z Target Id PDB1B8Z
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19992, TM0266 Molecular Weight 9992.53 Da.
    Residues 90 Isoelectric Point 10.36
    Sequence mnkkelidrvakkagakkkdvklildtiletitealakgekvqivgfgsfevrkaaarkgvnpqtrkpit iperkvpkfkpgkalkekvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2360000
    Matthews' coefficent 2.30 Rfactor 0.2150000
    Waters 77 Solvent Content 46.00

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch