The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of triosephosphate isomerase (TIM) from Thermotoga maritima: a comparative thermostability structural analysis of ten different TIM structures. Proteins 37 441-453 1999
    Site OTHER
    PDB Id 1b9b
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19942, Molecular Weight 28515.58 Da.
    Residues 255 Isoelectric Point 5.60
    Sequence itrklilagnwkmhktiseakkfvsllvnelhdvkefeivvcppftalsevgeilsgrniklgaqnvfye dqgaftgeisplmlqeigveyvivghserrrifkeddefinrkvkavlekgmtpilcvgetleerekgl tfcvvekqvregfygldkeeakrvviayepvwaigtgrvatpqqaqevhafirkllsemydeetagsir ilyggsikpdnflglivqkdidgglvggaslkesfielarimrgvis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.85 Rfree 0.2490000
    Matthews' coefficent 4.16 Rfactor 0.2109000
    Waters 52 Solvent Content 70.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch