.
The Open Protein Structure Annotation Network
PDB Keyword
.

1c3u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of adenylosuccinate lyase, an enzyme with dual activity in the de novo purine biosynthetic pathway. Structure Fold.Des. 8 163-174 2000
    Site OTHER
    PDB Id 1c3u Target Id PDB1C3U
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18700, TM1095 Molecular Weight 49870.67 Da.
    Residues 431 Isoelectric Point 6.18
    Sequence mveryslspmkdlwteeakyrrwlevelavtrayeelgmipkgvterirnnakidvelfkkieektnhdv vafvegigsmigedsrffhygltssdvldtanslalveagkilleslkefcdvlwevanrykhtptigr thgvhaeptsfglkvlgwysemkrnvqrleraieevsygkisgavgnyanvppeveekalsylglkpep vstqvvprdrhafylstlaivaagieriaveirhlqrtevleveepfrkgqrgssamphkknpitcerl tglsrmmrayvdpslenialwherdishssveryvfpdatqtlyymivtatnvvrnmkvneermkknid ltkglvfsqrvllkliekgltrkeaydivqrnalktwnsekhfleylledeevkklvtkeeleelfdis yylkhvdhiferfeke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2300000
    Matthews' coefficent 3.22 Rfactor 0.1990000
    Waters 392 Solvent Content 61.75

    Pathway

    Reactions found in Metabolic Reconstruction for TM1095

    Name: adenylsuccinate lyase
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : dcamp <==> amp + fum
    Classification: EC:4.3.2.2
     
    Name: adenylosuccinate lyase
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : 25aics <==> aicar + fum
    Classification: EC:4.3.2.2
     

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch