.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dl5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of protein isoaspartyl methyltransferase: a catalyst for protein repair. Structure Fold.Des. 8 1189-1201 2000
    Site OTHER
    PDB Id 1dl5 Target Id PDB1DL5
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS19968, TM0704 Molecular Weight 36398.06 Da.
    Residues 317 Isoelectric Point 5.48
    Sequence mreklfwilkkygvsdhiakafleipreefltksyplsyvyedivlvsyddgeeystssqpslmalfmew vgldkgmrvleigggtgynaavmsrvvgekglvvsveysrkiceiakrnverlgienvifvcgdgyygv pefspydvifvtvgvdevpetwftqlkeggrvivpinlklsrrqpaflfkkkdpylvgnykletrfita ggnlgnllernrkllrefpfnreillvrshifvelvdlltrrlteidgtfyyagpngvveflddrmriy gdapeienlltqwescgyrsfeylmlhvgynafshiscsi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.203
    Matthews' coefficent 2.57 Rfactor 0.182
    Waters 463 Solvent Content 51.70

    Ligand Information
    Ligands SAH (S-ADENOSYL-L-HOMOCYSTEINE) x 2
    Metals CD (CADMIUM) x 9;CL (CHLORIDE) x 10

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch