.
The Open Protein Structure Annotation Network
PDB Keyword
.

1dmg

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of ribosomal protein L4 shows RNA-binding sites for ribosome incorporation and feedback control of the S10 operon. EMBO J. 19 807-818 2000
    Site OTHER
    PDB Id 1dmg Target Id PDB1DMG
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS20000, TM1499 Molecular Weight 25642.52 Da.
    Residues 225 Isoelectric Point 9.97
    Sequence aqvdllnvkgekvgtleisdfvfnidpnydvmwryvdmqlsnrragtastktrgevsgggrkpwpqkhtg rarhgsirspiwrhggvvhgpkprdwskklnkkmkklalrsalsvkyrenkllvlddlklerpktkslk eilqnlqlsdkktlivlpwkeegymnvklsgrnlpdvkviiadnpnnskngekavridglnvfdmlkyd ylvltrdmvskieevlg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.2370000
    Matthews' coefficent 2.28 Rfactor 0.2080000
    Waters 213 Solvent Content 45.97

    Ligand Information
    Ligands CIT (CITRIC) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch