The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a NifS-like protein from Thermotoga maritima: implications for iron sulphur cluster assembly. J.Mol.Biol. 297 451-464 2000
    Site OTHER
    PDB Id 1ecx Target Id PDB1ECX
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS18712, TM1692 Molecular Weight 42866.30 Da.
    Residues 384 Isoelectric Point 8.86
    Sequence mrvyfdnnattrvddrvleemivfyrekygnpnsahgmgieanlhmekarekvakvlgvspseifftsca tesinwilktvaetfekrkrtiittpiehkavletmkylsmkgfkvkyvpvdsrgvvkleeleklvded tflvsimaannevgtiqpvedvtrivkkknketlvhvdavqtigkipfsleklevdyasfsahkfhgpk gvgityirkgvpirplihgggqerglrsgtqnvpgivgaarameiaveelseaakhmeklrsklvsglm nlgahiitpleislpntlsvsfpnirgstlqnllsgygiyvstssactskderlrhvldamgvdrriaq gairislckynteeevdyflkkieeilsfldltgnnrr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.2560000
    Matthews' coefficent 3.51 Rfactor 0.2070000
    Waters 179 Solvent Content 64.99

    Ligand Information
    Ligands PLP (PYRIDOXAL-5'-PHOSPHATE) x 2;CYS x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch